SCOPe 2.07: Domain d1jwga_: 1jwg A:

Lineage for d1jwga_ (1jwg A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.9: ENTH/VHS domain [48464] (5 families)

5. Family a.118.9.2: VHS domain [48468] (6 proteins)

6. Protein ADP-ribosylation factor binding protein Gga1 [74782] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74783] (5 PDB entries)

8. Domain d1jwga_: 1jwg A: [71911]
   complexed with cation-independent M6PR C-terminal peptide
   complexed with iod

Details for d1jwga_

PDB Entry: 1jwg, 2 Å

PDB Description: VHS Domain of human GGA1 complexed with cation-independent M6PR C-terminal Peptide

PDB Compounds: (A:) ADP-ribosylation factor binding protein GGA1

SCOPe Domain Sequences for d1jwga_:

Sequence; same for both SEQRES and ATOM records:

>d1jwga_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]}
petlearinratnplnkeldwasingfceqlnedfegpplatrllahkiqspqeweaiqa
ltvletcmkscgkrfhdevgkfrflnelikvvspkylgsrtsekvknkilellyswtvgl
peevkiaeayqmlkkqgivk

Timeline for d1jwga_:

• d1jwga_ first appeared in SCOP 1.61
  
• d1jwga_ appears in SCOPe 2.06
  
• d1jwga_ appears in the current release, SCOPe 2.08