Lineage for d1jvkb2 (1jvk B:113-215)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1109002Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 1109006Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries)
  8. 1109018Domain d1jvkb2: 1jvk B:113-215 [71900]
    Other proteins in same PDB: d1jvka1, d1jvkb1
    part of amyloidogenic protein BUR

Details for d1jvkb2

PDB Entry: 1jvk (more details), 1.94 Å

PDB Description: three-dimensional structure of an immunoglobulin light chain dimer acting as a lethal amyloid precursor
PDB Compounds: (B:) immunoglobulin lambda light chain

SCOPe Domain Sequences for d1jvkb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jvkb2 b.1.1.2 (B:113-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapta

SCOPe Domain Coordinates for d1jvkb2:

Click to download the PDB-style file with coordinates for d1jvkb2.
(The format of our PDB-style files is described here.)

Timeline for d1jvkb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jvkb1