Lineage for d1jvkb1 (1jvk B:1-112)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 157411Species Amyloidogenic lambda L chain BUR (human) [74825] (1 PDB entry)
  8. 157413Domain d1jvkb1: 1jvk B:1-112 [71899]
    Other proteins in same PDB: d1jvka2, d1jvkb2

Details for d1jvkb1

PDB Entry: 1jvk (more details), 1.94 Å

PDB Description: three-dimensional structure of an immunoglobulin light chain dimer acting as a lethal amyloid precursor

SCOP Domain Sequences for d1jvkb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jvkb1 b.1.1.1 (B:1-112) Immunoglobulin (variable domains of L and H chains) {Amyloidogenic lambda L chain BUR (human)}
etaltqpasvsgspgqsitvsctgvssivgsynlvswyqqhpgkapklltyevnkrpsgv
sdrfsgsksgnsasltisglqaedeadyycssydgsstsvvfgggtkltvlg

SCOP Domain Coordinates for d1jvkb1:

Click to download the PDB-style file with coordinates for d1jvkb1.
(The format of our PDB-style files is described here.)

Timeline for d1jvkb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jvkb2