Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
Species Amyloidogenic lambda L chain BUR (human) [74825] (1 PDB entry) |
Domain d1jvkb1: 1jvk B:1-112 [71899] Other proteins in same PDB: d1jvka2, d1jvkb2 |
PDB Entry: 1jvk (more details), 1.94 Å
SCOP Domain Sequences for d1jvkb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jvkb1 b.1.1.1 (B:1-112) Immunoglobulin (variable domains of L and H chains) {Amyloidogenic lambda L chain BUR (human)} etaltqpasvsgspgqsitvsctgvssivgsynlvswyqqhpgkapklltyevnkrpsgv sdrfsgsksgnsasltisglqaedeadyycssydgsstsvvfgggtkltvlg
Timeline for d1jvkb1: