SCOPe 2.06: Domain d1jvja_: 1jvj A:

Lineage for d1jvja_ (1jvj A:)

1. Root: SCOPe 2.06

2. Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein beta-Lactamase, class A [56606] (16 species)

7. Species Escherichia coli, TEM-1 [TaxId:562] [56607] (59 PDB entries)

8. Domain d1jvja_: 1jvj A: [71896]
   complexed with im2, k; mutant

Details for d1jvja_

PDB Entry: 1jvj, 1.73 Å

PDB Description: crystal structure of n132a mutant of tem-1 beta-lactamase in complex with a n-formimidoyl-thienamycine

PDB Compounds: (A:) Beta-lactamase TEM

SCOPe Domain Sequences for d1jvja_:

Sequence; same for both SEQRES and ATOM records:

>d1jvja_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]}
hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdataanlllttiggp
keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
sqatmdernrqiaeigaslikhw

Timeline for d1jvja_:

• d1jvja_ first appeared in SCOP 1.61
  
• d1jvja_ appears in SCOPe 2.05
  
• d1jvja_ appears in SCOPe 2.07
  
• d1jvja_ appears in the current release, SCOPe 2.08