Class b: All beta proteins [48724] (174 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.5: Quercetin 2,3-dioxygenase-like [75035] (3 proteins) Share a common two-domain fold with the 7S protein; there is a metal-binding site in the N-terminal domain similar to the metal-binding site of germin |
Protein Quercetin 2,3-dioxygenase [75036] (1 species) |
Species Aspergillus japonicus [TaxId:34381] [75037] (5 PDB entries) |
Domain d1juhd_: 1juh D: [71887] complexed with cu, edo, nag |
PDB Entry: 1juh (more details), 1.6 Å
SCOPe Domain Sequences for d1juhd_:
Sequence, based on SEQRES records: (download)
>d1juhd_ b.82.1.5 (D:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} livedapdhvrpyvirhysharavtvdtqlyrfyvtgpssgyaftlmgtnaphsdalgvl phihqkhyenfycnkgsfqlwaqsgnetqqtrvlssgdygsvprnvthtfqiqdpdtemt gvivpggfedlfyylgtnatdtthtpyipsssdsssttgpdsstistlqsfdvyaelsft prtdtvngtapantvwhtganalastagdpyfiangwgpkylnsqygyqivapfvtatqa qdtnytlstismsttpstvtvptwsfpgacafqvqegrvvvqigdyaatelgsgdvafip ggvefkyyseayfskvlfvssgsdgldqnlvnggeewssvsfpadw
>d1juhd_ b.82.1.5 (D:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} livedapdhvrpyvirhysharavtvdtqlyrfyvtgpssgyaftlmgtnaphsdalgvl phihqkhyenfycnkgsfqlwaqsgnetqqtrvlssgdygsvprnvthtfqiqdpdtemt gvivpggfedlfyylgtnatdtthtpyipstlqsfdvyaelsftprtdtvngtapantvw htganalastagdpyfiangwgpkylnsqygyqivapfvtatqaqdtnytlstismsttp stvtvptwsfpgacafqvqegrvvvqigdyaatelgsgdvafipggvefkyyseayfskv lfvssgsdgldqnlvnggeewssvsfpadw
Timeline for d1juhd_: