Lineage for d1jufa2 (1juf A:1-181)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405985Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1405986Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1405987Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1406058Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1406349Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (25 PDB entries)
  8. 1406352Domain d1jufa2: 1juf A:1-181 [71882]
    Other proteins in same PDB: d1jufa1, d1jufb_

Details for d1jufa2

PDB Entry: 1juf (more details), 2 Å

PDB Description: structure of minor histocompatibility antigen peptide, h13b, complexed to h2-db
PDB Compounds: (A:) H2-Db major histocompatibility antigen

SCOPe Domain Sequences for d1jufa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jufa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

SCOPe Domain Coordinates for d1jufa2:

Click to download the PDB-style file with coordinates for d1jufa2.
(The format of our PDB-style files is described here.)

Timeline for d1jufa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jufa1
View in 3D
Domains from other chains:
(mouse over for more information)
d1jufb_