SCOPe 2.08: Domain d1jufa2: 1juf A:1-181

Lineage for d1jufa2 (1juf A:1-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (29 PDB entries)

8. Domain d1jufa2: 1juf A:1-181 [71882]
   Other proteins in same PDB: d1jufa1, d1jufb_

Details for d1jufa2

PDB Entry: 1juf, 2 Å

PDB Description: structure of minor histocompatibility antigen peptide, h13b, complexed to h2-db

PDB Compounds: (A:) H2-Db major histocompatibility antigen

SCOPe Domain Sequences for d1jufa2:

Sequence; same for both SEQRES and ATOM records:

>d1jufa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
gphsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeyw
eretqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayeg
rdyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatll
r

Timeline for d1jufa2:

• d1jufa2 first appeared in SCOP 1.61
  
• d1jufa2 appears in SCOPe 2.07