Lineage for d1jufa1 (1juf A:182-276)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2358143Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2358446Species Mouse (Mus musculus) [TaxId:10090] [88606] (110 PDB entries)
    Uniprot P01901 22-299
  8. 2358524Domain d1jufa1: 1juf A:182-276 [71881]
    Other proteins in same PDB: d1jufa2, d1jufb_

Details for d1jufa1

PDB Entry: 1juf (more details), 2 Å

PDB Description: structure of minor histocompatibility antigen peptide, h13b, complexed to h2-db
PDB Compounds: (A:) H2-Db major histocompatibility antigen

SCOPe Domain Sequences for d1jufa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jufa1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrwer

SCOPe Domain Coordinates for d1jufa1:

Click to download the PDB-style file with coordinates for d1jufa1.
(The format of our PDB-style files is described here.)

Timeline for d1jufa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jufa2
View in 3D
Domains from other chains:
(mouse over for more information)
d1jufb_