Lineage for d1jtrb1 (1jtr B:1-117)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 158716Protein T-cell antigen receptor [48933] (6 species)
  7. 158773Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (15 PDB entries)
  8. 158784Domain d1jtrb1: 1jtr B:1-117 [71869]
    Other proteins in same PDB: d1jtra2, d1jtrb2, d1jtrc2, d1jtrd2, d1jtrh1, d1jtrh2, d1jtri1, d1jtri2, d1jtrl1, d1jtrm1

Details for d1jtrb1

PDB Entry: 1jtr (more details), 2.4 Å

PDB Description: 2C/H-2Kbm3/dEV8 allogeneic complex

SCOP Domain Sequences for d1jtrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jtrb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
eaavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdi
pdgykasrpsqenfslilelatpsqtsvyfcasggggtlyfgagtrlsvle

SCOP Domain Coordinates for d1jtrb1:

Click to download the PDB-style file with coordinates for d1jtrb1.
(The format of our PDB-style files is described here.)

Timeline for d1jtrb1:

  • d1jtrb1 is new in SCOP 1.61
  • d1jtrb1 does not appear in SCOP 1.63