Lineage for d1jtma_ (1jtm A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2152584Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 2152585Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 2153717Family d.2.1.3: Phage lysozyme [53981] (4 protein domains)
  6. 2153723Protein Phage T4 lysozyme [53982] (1 species)
  7. 2153724Species Bacteriophage T4 [TaxId:10665] [53983] (570 PDB entries)
    Uniprot P00720
    many mutant structures
  8. 2154216Domain d1jtma_: 1jtm A: [71864]
    complexed with bme

Details for d1jtma_

PDB Entry: 1jtm (more details), 1.9 Å

PDB Description: alternative structures of a sequence extended t4 lysozyme show that the highly conserved beta-sheet has weak intrinsic folding propensity
PDB Compounds: (A:) lysozyme

SCOPe Domain Sequences for d1jtma_:

Sequence, based on SEQRES records: (download)

>d1jtma_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknletyytigighlltk

Sequence, based on observed residues (ATOM records): (download)

>d1jtma_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdaykgighlltk

SCOPe Domain Coordinates for d1jtma_:

Click to download the PDB-style file with coordinates for d1jtma_.
(The format of our PDB-style files is described here.)

Timeline for d1jtma_: