![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.97: Cytidine deaminase-like [53926] (3 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 2 is antiparallel to the rest |
![]() | Superfamily c.97.1: Cytidine deaminase-like [53927] (2 families) ![]() |
![]() | Family c.97.1.1: Cytidine deaminase [53928] (2 proteins) |
![]() | Protein mono-domain cytidine deaminase [75327] (2 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [75328] (1 PDB entry) |
![]() | Domain d1jtkb_: 1jtk B: [71863] complexed with thu, zn |
PDB Entry: 1jtk (more details), 2.04 Å
SCOP Domain Sequences for d1jtkb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jtkb_ c.97.1.1 (B:) mono-domain cytidine deaminase {Bacillus subtilis} mnrqelitealkardmayapyskfqvgaalltkdgkvyrgcnienaaysmcncaertalf kavsegdtefqmlavaadtpgpvspcgacrqviselctkdvivvltnlqgqikemtveel lpgafssedlh
Timeline for d1jtkb_: