SCOP 1.67: Domain d1jtkb_: 1jtk B:

Lineage for d1jtkb_ (1jtk B:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (3 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 2 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (2 families)

5. Family c.97.1.1: Cytidine deaminase [53928] (2 proteins)

6. Protein mono-domain cytidine deaminase [75327] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [75328] (1 PDB entry)

8. Domain d1jtkb_: 1jtk B: [71863]
   complexed with thu, zn

Details for d1jtkb_

PDB Entry: 1jtk, 2.04 Å

PDB Description: crystal structure of cytidine deaminase from bacillus subtilis in complex with the inhibitor tetrahydrodeoxyuridine

SCOP Domain Sequences for d1jtkb_:

Sequence; same for both SEQRES and ATOM records:

>d1jtkb_ c.97.1.1 (B:) mono-domain cytidine deaminase {Bacillus subtilis}
mnrqelitealkardmayapyskfqvgaalltkdgkvyrgcnienaaysmcncaertalf
kavsegdtefqmlavaadtpgpvspcgacrqviselctkdvivvltnlqgqikemtveel
lpgafssedlh

Timeline for d1jtkb_:

• d1jtkb_ first appeared in SCOP 1.61
  
• d1jtkb_ appears in SCOP 1.65
  
• d1jtkb_ appears in SCOP 1.69
  
• d1jtkb_ appears in the current release, SCOPe 2.08