Lineage for d1jtka_ (1jtk A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1010298Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 1010299Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 1010300Family c.97.1.1: Cytidine deaminase [53928] (4 proteins)
    strand 5 is antiparallel to strand 4
  6. 1010304Protein mono-domain cytidine deaminase [75327] (5 species)
  7. 1010308Species Bacillus subtilis [TaxId:1423] [75328] (4 PDB entries)
    Uniprot P19079
  8. 1010313Domain d1jtka_: 1jtk A: [71862]
    complexed with thu, zn

Details for d1jtka_

PDB Entry: 1jtk (more details), 2.04 Å

PDB Description: crystal structure of cytidine deaminase from bacillus subtilis in complex with the inhibitor tetrahydrodeoxyuridine
PDB Compounds: (A:) Cytidine deaminase

SCOPe Domain Sequences for d1jtka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jtka_ c.97.1.1 (A:) mono-domain cytidine deaminase {Bacillus subtilis [TaxId: 1423]}
mnrqelitealkardmayapyskfqvgaalltkdgkvyrgcnienaaysmcncaertalf
kavsegdtefqmlavaadtpgpvspcgacrqviselctkdvivvltnlqgqikemtveel
lpgafssedlh

SCOPe Domain Coordinates for d1jtka_:

Click to download the PDB-style file with coordinates for d1jtka_.
(The format of our PDB-style files is described here.)

Timeline for d1jtka_: