Lineage for d1jtka_ (1jtk A:)
- Root: SCOP 1.63
Class c: Alpha and beta proteins (a/b) [51349] (117 folds) 
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 2 is antiparallel to the rest
Superfamily c.97.1: Cytidine deaminase-like [53927] (1 family) 
Family c.97.1.1: Cytidine deaminase-like [53928] (2 proteins) 
Protein mono-domain cytidine deaminase [75327] (1 species) Species Bacillus subtilis [TaxId:1423] [75328] (1 PDB entry) 
Domain d1jtka_: 1jtk A: [71862]
Details for d1jtka_
PDB Entry: 1jtk (more details), 2.04 Å
PDB Description: crystal structure of cytidine deaminase from bacillus subtilis in complex with the inhibitor tetrahydrodeoxyuridine
SCOP Domain Sequences for d1jtka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jtka_ c.97.1.1 (A:) mono-domain cytidine deaminase {Bacillus subtilis}
mnrqelitealkardmayapyskfqvgaalltkdgkvyrgcnienaaysmcncaertalf
kavsegdtefqmlavaadtpgpvspcgacrqviselctkdvivvltnlqgqikemtveel
lpgafssedlh
SCOP Domain Coordinates for d1jtka_:
Click to download the PDB-style file with coordinates for d1jtka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jtka_:
- d1jtka_ first appeared in SCOP 1.61
- d1jtka_ appears in SCOP 1.65
- d1jtka_ appears in the current release, SCOPe 2.08
View in 3D
