Lineage for d1jtea_ (1jte A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2129933Family c.66.1.25: mRNA cap methylase [88785] (3 protein domains)
  6. 2129955Protein Polymerase regulatory subunit VP39 [53361] (2 species)
  7. 2129960Species Vaccinia virus [TaxId:10245] [53362] (17 PDB entries)
  8. 2129971Domain d1jtea_: 1jte A: [71860]
    complexed with sah; mutant

Details for d1jtea_

PDB Entry: 1jte (more details), 2 Å

PDB Description: Crystal Structure Analysis of VP39 F180W mutant
PDB Compounds: (A:) vp39

SCOPe Domain Sequences for d1jtea_:

Sequence, based on SEQRES records: (download)

>d1jtea_ c.66.1.25 (A:) Polymerase regulatory subunit VP39 {Vaccinia virus [TaxId: 10245]}
mdvvsldkpfmyfeeidneldyepesanevakklpyqgqlklllgelfflsklqrhgild
gatvvyigsapgthirylrdhfynlgviikwmlidgrhhdpilnglrdvtlvtrfvdeey
lrsikkqlhpskiilisdvrskrggnepstadllsnyalqnvmisilnpvasslkwrcpw
pdqwikdfyiphgnkmlqpfapsysaemrllsiytgenmrltrvtksdavnyekkmyyln
kivrnkvvvnfdypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrflnip

Sequence, based on observed residues (ATOM records): (download)

>d1jtea_ c.66.1.25 (A:) Polymerase regulatory subunit VP39 {Vaccinia virus [TaxId: 10245]}
mdvvsldkpfmyfeeidneldyepesanevakklpyqgqlklllgelfflsklqrhgild
gatvvyigsapgthirylrdhfynlgviikwmlidgrhhdpilnglrdvtlvtrfvdeey
lrsikkqlhpskiilisdvrspstadllsnyalqnvmisilnpvasslkwrcpwpdqwik
dfyiphgnkmlqpfapsysaemrllsiytgenmrltrvtksdavnyekkmyylnkivrnk
vvvnfdypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrflnip

SCOPe Domain Coordinates for d1jtea_:

Click to download the PDB-style file with coordinates for d1jtea_.
(The format of our PDB-style files is described here.)

Timeline for d1jtea_: