SCOPe 2.05: Domain d1jt2a_: 1jt2 A:

Lineage for d1jt2a_ (1jt2 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.2: Carboxylesterase [53487] (7 proteins)

6. Protein Feruloyl esterase domain of the cellulosomal xylanase z [69577] (1 species)

7. Species Clostridium thermocellum [TaxId:1515] [69578] (2 PDB entries)

8. Domain d1jt2a_: 1jt2 A: [71858]
   complexed with fer

Details for d1jt2a_

PDB Entry: 1jt2, 1.8 Å

PDB Description: structural basis for the substrate specificity of the ferul domain of the cellulosomal xylanase z from c. thermocellum

PDB Compounds: (A:) protein (endo-1,4-beta-xylanase z)

SCOPe Domain Sequences for d1jt2a_:

Sequence; same for both SEQRES and ATOM records:

>d1jt2a_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]}
slptmppsgydqvrngvprgqvvnisyfstatnstrparvylppgyskdkkysvlyllhg
iggsendwfegggranviadnliaegkikpliivtpntnaagpgiadgyenftkdllnsl
ipyiesnysvytdrehraiaglamgggqsfnigltnldkfayigpisaapntypnerlfp
dggkaareklkllfiacgtndsligfgqrvheycvanninhvywliqggghdfnvwkpgl
wnflqmadeagltrd

Timeline for d1jt2a_:

• d1jt2a_ first appeared in SCOP 1.61
  
• d1jt2a_ appears in SCOPe 2.04
  
• d1jt2a_ appears in SCOPe 2.06
  
• d1jt2a_ appears in the current release, SCOPe 2.08