SCOP 1.69: Domain d1jt0c1: 1jt0 C:2-72

Lineage for d1jt0c1 (1jt0 C:2-72)

Root: SCOP 1.69
Class a: All alpha proteins [46456] (218 folds)
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
Superfamily a.4.1: Homeodomain-like [46689] (13 families)
consists only of helices
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (9 proteins)
Protein Multidrug binding protein QacR [68964] (1 species)
Species Staphylococcus aureus [TaxId:1280] [68965] (11 PDB entries)
Domain d1jt0c1: 1jt0 C:2-72 [71854]
Other proteins in same PDB: d1jt0a2, d1jt0b2, d1jt0c2, d1jt0d2

Details for d1jt0c1

PDB Entry: 1jt0 (more details), 2.9 Å

PDB Description: crystal structure of a cooperative qacr-dna complex

SCOP Domain Sequences for d1jt0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jt0c1 a.4.1.9 (C:2-72) Multidrug binding protein QacR {Staphylococcus aureus}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkkeqika

SCOP Domain Coordinates for d1jt0c1:

Click to download the PDB-style file with coordinates for d1jt0c1.
(The format of our PDB-style files is described here.)

Timeline for d1jt0c1: