Class a: All alpha proteins [46456] (218 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (13 families) consists only of helices |
Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (9 proteins) |
Protein Multidrug binding protein QacR [68964] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [68965] (11 PDB entries) |
Domain d1jt0c1: 1jt0 C:2-72 [71854] Other proteins in same PDB: d1jt0a2, d1jt0b2, d1jt0c2, d1jt0d2 |
PDB Entry: 1jt0 (more details), 2.9 Å
SCOP Domain Sequences for d1jt0c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jt0c1 a.4.1.9 (C:2-72) Multidrug binding protein QacR {Staphylococcus aureus} nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw qeqwkkeqika
Timeline for d1jt0c1: