SCOPe 2.05: Domain d1jt0b1: 1jt0 B:2-72

Lineage for d1jt0b1 (1jt0 B:2-72)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Multidrug binding protein QacR [68964] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [68965] (24 PDB entries)
   Uniprot P23217

8. Domain d1jt0b1: 1jt0 B:2-72 [71852]
   Other proteins in same PDB: d1jt0a2, d1jt0b2, d1jt0c2, d1jt0d2
   protein/DNA complex; complexed with so4

Details for d1jt0b1

PDB Entry: 1jt0, 2.9 Å

PDB Description: crystal structure of a cooperative qacr-dna complex

PDB Compounds: (B:) hypothetical transcriptional regulator in qaca 5'region

SCOPe Domain Sequences for d1jt0b1:

Sequence; same for both SEQRES and ATOM records:

>d1jt0b1 a.4.1.9 (B:2-72) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
qeqwkkeqika

Timeline for d1jt0b1:

• d1jt0b1 first appeared in SCOP 1.61
  
• d1jt0b1 appears in SCOPe 2.04
  
• d1jt0b1 appears in SCOPe 2.06
  
• d1jt0b1 appears in the current release, SCOPe 2.08