Lineage for d1jsya1 (1jsy A:6-175)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.5: E set domains [49208] (27 proteins) 
Protein Arrestin [49244] (2 species) Species Cow (Bos taurus), beta-arrestin 1 [TaxId:9913] [69169] (3 PDB entries) 
Domain d1jsya1: 1jsy A:6-175 [71847]
Details for d1jsya1
PDB Entry: 1jsy (more details), 2.9 Å
PDB Description: Crystal structure of bovine arrestin-2
SCOP Domain Sequences for d1jsya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jsya1 b.1.1.5 (A:6-175) Arrestin {Cow (Bos taurus), beta-arrestin 1}
trvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltcafrygr
edldvlgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeippnlpc
svtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyap
SCOP Domain Coordinates for d1jsya1:
Click to download the PDB-style file with coordinates for d1jsya1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jsya1:
- d1jsya1 is new in SCOP 1.61
- d1jsya1 appears in SCOP 1.63
- d1jsya1 appears in the current release, SCOPe 2.08
View in 3D
