| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.11: Arrestin/Vps26-like [81291] (2 proteins) |
| Protein Arrestin [49244] (3 species) duplication: contains tandem repeat of two elaborated Ig-like domains contacting each other head-to-head |
| Species Cow (Bos taurus), beta-arrestin 1 [TaxId:9913] [69169] (6 PDB entries) |
| Domain d1jsya1: 1jsy A:6-175 [71847] |
PDB Entry: 1jsy (more details), 2.9 Å
SCOPe Domain Sequences for d1jsya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jsya1 b.1.18.11 (A:6-175) Arrestin {Cow (Bos taurus), beta-arrestin 1 [TaxId: 9913]}
trvfkkaspngkltvylgkrdfvdhidlvepvdgvvlvdpeylkerrvyvtltcafrygr
edldvlgltfrkdlfvanvqsfppapedkkpltrlqerlikklgehaypftfeippnlpc
svtlqpgpedtgkacgvdyevkafcaenleekihkrnsvrlvirkvqyap
Timeline for d1jsya1: