![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.2: Bromodomain [47370] (2 families) ![]() |
![]() | Family a.29.2.1: Bromodomain [47371] (5 proteins) |
![]() | Protein CREB-binding protein, CBP [74712] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [74713] (7 PDB entries) |
![]() | Domain d1jspb_: 1jsp B: [71843] complexed with p53 peptide, chain A protein/DNA complex |
PDB Entry: 1jsp (more details)
SCOPe Domain Sequences for d1jspb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jspb_ a.29.2.1 (B:) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} gshmrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdls tikrkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl g
Timeline for d1jspb_: