SCOPe 2.08: Domain d1jspb1: 1jsp B:1081-1197

Lineage for d1jspb1 (1jsp B:1081-1197)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (6 proteins)

6. Protein CREB-binding protein, CBP [74712] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [74713] (59 PDB entries)

8. Domain d1jspb1: 1jsp B:1081-1197 [71843]
   Other proteins in same PDB: d1jspb2
   complexed with p53 peptide, chain A
   protein/DNA complex

Details for d1jspb1

PDB Entry: 1jsp

PDB Description: nmr structure of cbp bromodomain in complex with p53 peptide

PDB Compounds: (B:) creb-binding protein

SCOPe Domain Sequences for d1jspb1:

Sequence; same for both SEQRES and ATOM records:

>d1jspb1 a.29.2.1 (B:1081-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]}
rkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikr
kldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

Timeline for d1jspb1:

• d1jspb1 first appeared in SCOP 1.61, called d1jspb_
  
• d1jspb1 appears in SCOPe 2.07