SCOPe 2.05: Domain d1js9a_: 1js9 A:

Lineage for d1js9a_ (1js9 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.5: Bromoviridae-like VP [88639] (2 proteins)

6. Protein Cucumovirus coat protein [88640] (4 species)

7. Species BMV (Brome mosaic virus) [TaxId:12302] [74886] (2 PDB entries)

8. Domain d1js9a_: 1js9 A: [71840]
   complexed with edo, mg

Details for d1js9a_

PDB Entry: 1js9, 3.4 Å

PDB Description: brome mosaic virus

PDB Compounds: (A:) coat protein

SCOPe Domain Sequences for d1js9a_:

Sequence; same for both SEQRES and ATOM records:

>d1js9a_ b.121.4.5 (A:) Cucumovirus coat protein {BMV (Brome mosaic virus) [TaxId: 12302]}
kaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlgllpsv
agrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiylyase
avpakavvvhlevehvrptfddfftpvyr

Timeline for d1js9a_:

• d1js9a_ first appeared in SCOP 1.61
  
• d1js9a_ appears in SCOPe 2.04
  
• d1js9a_ appears in SCOPe 2.06
  
• d1js9a_ appears in the current release, SCOPe 2.08