Lineage for d1js9a_ (1js9 A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 812424Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 812561Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (9 families) (S)
  5. 812883Family b.121.4.5: Bromoviridae-like VP [88639] (1 protein)
  6. 812884Protein Cucumovirus coat protein [88640] (4 species)
  7. 812885Species BMV (Brome mosaic virus) [TaxId:12302] [74886] (2 PDB entries)
  8. 812916Domain d1js9a_: 1js9 A: [71840]

Details for d1js9a_

PDB Entry: 1js9 (more details), 3.4 Å

PDB Description: brome mosaic virus
PDB Compounds: (A:) coat protein

SCOP Domain Sequences for d1js9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1js9a_ b.121.4.5 (A:) Cucumovirus coat protein {BMV (Brome mosaic virus) [TaxId: 12302]}
kaikaiagysiskweassdaitakatnamsitlphelsseknkelkvgrvllwlgllpsv
agrikacvaekqaqaeaafqvalavadsskevvaamytdafrgatlgdllnlqiylyase
avpakavvvhlevehvrptfddfftpvyr

SCOP Domain Coordinates for d1js9a_:

Click to download the PDB-style file with coordinates for d1js9a_.
(The format of our PDB-style files is described here.)

Timeline for d1js9a_: