Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) |
Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (4 proteins) |
Protein Transcarbamylase-like protein [75308] (1 species) |
Species Bacteroides fragilis [TaxId:817] [75309] (4 PDB entries) |
Domain d1js1z2: 1js1 Z:164-317 [71839] Other proteins in same PDB: d1js1x3, d1js1y3, d1js1z3 complexed with po4 |
PDB Entry: 1js1 (more details), 2 Å
SCOPe Domain Sequences for d1js1z2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1js1z2 c.78.1.1 (Z:164-317) Transcarbamylase-like protein {Bacteroides fragilis [TaxId: 817]} tarpkvvmtwaphprplpqavpnsfaewmnatdyefvithpegyeldpkfvgnarveydq mkafegadfiyaknwaaytgdnygqilstdrnwtvgdrqmavtnnayfmhclpvrrnmiv tddviespqsivipeaanreisatvvlkrllenl
Timeline for d1js1z2: