SCOPe 2.08: Domain d1jrkd1: 1jrk D:1-143

Lineage for d1jrkd1 (1jrk D:1-143)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein Hypothetical protein PAE3301 [75527] (1 species)

7. Species Pyrobaculum aerophilum [TaxId:13773] [75528] (3 PDB entries)

8. Domain d1jrkd1: 1jrk D:1-143 [71830]
   Other proteins in same PDB: d1jrka2, d1jrkb2, d1jrkc2, d1jrkd2
   structural genomics
   complexed with mpd
   has additional insertions and/or extensions that are not grouped together

Details for d1jrkd1

PDB Entry: 1jrk, 2.4 Å

PDB Description: Crystal Structure of a Nudix Protein from Pyrobaculum aerophilum Reveals a Dimer with Intertwined Beta Sheets

PDB Compounds: (D:) Nudix homolog

SCOPe Domain Sequences for d1jrkd1:

Sequence; same for both SEQRES and ATOM records:

>d1jrkd1 d.113.1.1 (D:1-143) Hypothetical protein PAE3301 {Pyrobaculum aerophilum [TaxId: 13773]}
mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
tfpnvrkvvslalstlyrlgkis

Timeline for d1jrkd1:

• d1jrkd1 first appeared in SCOP 1.61, called d1jrkd_
  
• d1jrkd1 appears in SCOPe 2.07