![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (7 families) ![]() |
![]() | Family d.113.1.1: MutT-like [55812] (16 proteins) |
![]() | Protein Hypothetical protein PAE3301 [75527] (1 species) |
![]() | Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [75528] (3 PDB entries) |
![]() | Domain d1jrkc_: 1jrk C: [71829] structural genomics |
PDB Entry: 1jrk (more details), 2.4 Å
SCOP Domain Sequences for d1jrkc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jrkc_ d.113.1.1 (C:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie tfpnvrkvvslalstlyrlgkisklaaa
Timeline for d1jrkc_: