Lineage for d1jrkc_ (1jrk C:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 609724Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 609725Superfamily d.113.1: Nudix [55811] (5 families) (S)
  5. 609726Family d.113.1.1: MutT-like [55812] (10 proteins)
  6. 609796Protein Hypothetical protein PAE3301 [75527] (1 species)
  7. 609797Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [75528] (3 PDB entries)
  8. 609804Domain d1jrkc_: 1jrk C: [71829]

Details for d1jrkc_

PDB Entry: 1jrk (more details), 2.4 Å

PDB Description: Crystal Structure of a Nudix Protein from Pyrobaculum aerophilum Reveals a Dimer with Intertwined Beta Sheets

SCOP Domain Sequences for d1jrkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrkc_ d.113.1.1 (C:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum}
mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
tfpnvrkvvslalstlyrlgkisklaaa

SCOP Domain Coordinates for d1jrkc_:

Click to download the PDB-style file with coordinates for d1jrkc_.
(The format of our PDB-style files is described here.)

Timeline for d1jrkc_: