Lineage for d1jrkc_ (1jrk C:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.113: Nudix [55810] (1 superfamily) Superfamily d.113.1: Nudix [55811] (2 families) 
Family d.113.1.1: MutT-like [55812] (4 proteins) 
Protein Hypothetical protein PAE3301 [75527] (1 species) Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [75528] (3 PDB entries) 
Domain d1jrkc_: 1jrk C: [71829]
Details for d1jrkc_
PDB Entry: 1jrk (more details), 2.4 Å
PDB Description: Crystal Structure of a Nudix Protein from Pyrobaculum aerophilum Reveals a Dimer with Intertwined Beta Sheets
SCOP Domain Sequences for d1jrkc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jrkc_ d.113.1.1 (C:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum}
mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
tfpnvrkvvslalstlyrlgkisklaaa
SCOP Domain Coordinates for d1jrkc_:
Click to download the PDB-style file with coordinates for d1jrkc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jrkc_:
- d1jrkc_ is new in SCOP 1.61
- d1jrkc_ appears in SCOP 1.63
- d1jrkc_ appears in the current release, SCOPe 2.08, called d1jrkc1
View in 3D
