SCOPe 2.05: Domain d1jrkb_: 1jrk B:

Lineage for d1jrkb_ (1jrk B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein Hypothetical protein PAE3301 [75527] (1 species)

7. Species Pyrobaculum aerophilum [TaxId:13773] [75528] (3 PDB entries)

8. Domain d1jrkb_: 1jrk B: [71828]
   structural genomics
   complexed with mpd

Details for d1jrkb_

PDB Entry: 1jrk, 2.4 Å

PDB Description: Crystal Structure of a Nudix Protein from Pyrobaculum aerophilum Reveals a Dimer with Intertwined Beta Sheets

PDB Compounds: (B:) Nudix homolog

SCOPe Domain Sequences for d1jrkb_:

Sequence; same for both SEQRES and ATOM records:

>d1jrkb_ d.113.1.1 (B:) Hypothetical protein PAE3301 {Pyrobaculum aerophilum [TaxId: 13773]}
mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
tfpnvrkvvslalstlyrlgkisklaa

Timeline for d1jrkb_:

• d1jrkb_ first appeared in SCOP 1.61
  
• d1jrkb_ appears in SCOPe 2.04
  
• d1jrkb_ is called d1jrkb1 in SCOPe 2.06
  
• d1jrkb_ appears in the current release, SCOPe 2.08, called d1jrkb1