Lineage for d1jrkb_ (1jrk B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1038513Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 1038514Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 1038515Family d.113.1.1: MutT-like [55812] (17 proteins)
  6. 1038617Protein Hypothetical protein PAE3301 [75527] (1 species)
  7. 1038618Species Pyrobaculum aerophilum [TaxId:13773] [75528] (3 PDB entries)
  8. 1038624Domain d1jrkb_: 1jrk B: [71828]
    structural genomics
    complexed with mpd

Details for d1jrkb_

PDB Entry: 1jrk (more details), 2.4 Å

PDB Description: Crystal Structure of a Nudix Protein from Pyrobaculum aerophilum Reveals a Dimer with Intertwined Beta Sheets
PDB Compounds: (B:) Nudix homolog

SCOPe Domain Sequences for d1jrkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrkb_ d.113.1.1 (B:) Hypothetical protein PAE3301 {Pyrobaculum aerophilum [TaxId: 13773]}
mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
tfpnvrkvvslalstlyrlgkisklaa

SCOPe Domain Coordinates for d1jrkb_:

Click to download the PDB-style file with coordinates for d1jrkb_.
(The format of our PDB-style files is described here.)

Timeline for d1jrkb_: