Lineage for d1jrkb_ (1jrk B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 195877Fold d.113: Nudix [55810] (1 superfamily)
  4. 195878Superfamily d.113.1: Nudix [55811] (2 families) (S)
  5. 195879Family d.113.1.1: MutT-like [55812] (4 proteins)
  6. 195896Protein Hypothetical protein PAE3301 [75527] (1 species)
  7. 195897Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [75528] (3 PDB entries)
  8. 195903Domain d1jrkb_: 1jrk B: [71828]

Details for d1jrkb_

PDB Entry: 1jrk (more details), 2.4 Å

PDB Description: Crystal Structure of a Nudix Protein from Pyrobaculum aerophilum Reveals a Dimer with Intertwined Beta Sheets

SCOP Domain Sequences for d1jrkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrkb_ d.113.1.1 (B:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum}
mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
tfpnvrkvvslalstlyrlgkisklaa

SCOP Domain Coordinates for d1jrkb_:

Click to download the PDB-style file with coordinates for d1jrkb_.
(The format of our PDB-style files is described here.)

Timeline for d1jrkb_: