Lineage for d1jrka_ (1jrk A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 261392Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 261393Superfamily d.113.1: Nudix [55811] (2 families) (S)
  5. 261394Family d.113.1.1: MutT-like [55812] (4 proteins)
  6. 261413Protein Hypothetical protein PAE3301 [75527] (1 species)
  7. 261414Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [75528] (3 PDB entries)
  8. 261419Domain d1jrka_: 1jrk A: [71827]

Details for d1jrka_

PDB Entry: 1jrk (more details), 2.4 Å

PDB Description: Crystal Structure of a Nudix Protein from Pyrobaculum aerophilum Reveals a Dimer with Intertwined Beta Sheets

SCOP Domain Sequences for d1jrka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrka_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum}
mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft
ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie
tfpnvrkvvslalstlyrlgkisklaaa

SCOP Domain Coordinates for d1jrka_:

Click to download the PDB-style file with coordinates for d1jrka_.
(The format of our PDB-style files is described here.)

Timeline for d1jrka_: