![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (2 families) ![]() |
![]() | Family d.113.1.1: MutT-like [55812] (4 proteins) |
![]() | Protein Hypothetical protein PAE3301 [75527] (1 species) |
![]() | Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [75528] (3 PDB entries) |
![]() | Domain d1jrka_: 1jrk A: [71827] |
PDB Entry: 1jrk (more details), 2.4 Å
SCOP Domain Sequences for d1jrka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jrka_ d.113.1.1 (A:) Hypothetical protein PAE3301 {Archaeon Pyrobaculum aerophilum} mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie tfpnvrkvvslalstlyrlgkisklaaa
Timeline for d1jrka_: