![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
![]() | Family d.113.1.1: MutT-like [55812] (17 proteins) |
![]() | Protein Hypothetical protein PAE3301 [75527] (1 species) |
![]() | Species Pyrobaculum aerophilum [TaxId:13773] [75528] (3 PDB entries) |
![]() | Domain d1jrka1: 1jrk A:1-143 [71827] Other proteins in same PDB: d1jrka2, d1jrkb2, d1jrkc2, d1jrkd2 structural genomics complexed with mpd has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1jrk (more details), 2.4 Å
SCOPe Domain Sequences for d1jrka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jrka1 d.113.1.1 (A:1-143) Hypothetical protein PAE3301 {Pyrobaculum aerophilum [TaxId: 13773]} mivtsgvlvengkvllvkhkrlgvyiypgghvehnetpieavkrefeeetgivvepigft ygiidenaverpmplvileevvkypeethihfdliylvkrvggdlkngewidvreidrie tfpnvrkvvslalstlyrlgkis
Timeline for d1jrka1: