Lineage for d1jrgb_ (1jrg B:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 171509Fold b.80: Single-stranded right-handed beta-helix [51125] (5 superfamilies)
  4. 171510Superfamily b.80.1: Pectin lyase-like [51126] (8 families) (S)
  5. 171511Family b.80.1.1: Pectate lyase [51127] (1 protein)
  6. 171512Protein Pectate lyase [51128] (5 species)
  7. 171518Species Erwinia chrysanthemi, type A [TaxId:556] [75024] (2 PDB entries)
  8. 171521Domain d1jrgb_: 1jrg B: [71826]

Details for d1jrgb_

PDB Entry: 1jrg (more details), 2.1 Å

PDB Description: Crystal Structure of the R3 form of Pectate Lyase A, Erwinia chrysanthemi

SCOP Domain Sequences for d1jrgb_:

Sequence, based on SEQRES records: (download)

>d1jrgb_ b.80.1.1 (B:) Pectate lyase {Erwinia chrysanthemi, type A}
aelvsdkalesaptvgwasqngfttggaaatsdniyivtniseftsalsagaeakiiqik
gtidisggtpytdfadqkarsqinipanttviglgtdakfingsliidgtdgtnnviirn
vyiqtpidvephyekgdgwnaewdamnitngahhvwidhvtisdgnftddmyttkdgety
vqhdgaldikrgsdyvtisnslidqhdktmlighndtnsaqdkgklhvtlfnnvfnrvte
raprvrygsihsfnnvfkgdakdpvyryqysfgigtsgsvlsegnsftianlsaskackv
vkkfngsifsdngsvlngsavdlsgcgfsaytskipyiydvqpmttelaqsitdnagsgk
l

Sequence, based on observed residues (ATOM records): (download)

>d1jrgb_ b.80.1.1 (B:) Pectate lyase {Erwinia chrysanthemi, type A}
aelvsdkalesaptvgwasqngfttggaaatsdniyivtniseftsalsagaeakiiqik
gtidisggtpytdfadqkarsqinipanttviglgtdakfingsliidgtdgtnnviirn
vyiqtpidvephyekgdgwnaewdamnitngahhvwidhvtisdgnftddmyttkdgety
vqhdgaldikrgsdyvtisnslidqhdktmligklhvtlfnnvfnrvteraprvrygsih
sfnnvfkgdakdpvyryqysfgigtsgsvlsegnsftianlsaskackvvkkfngsifsd
ngsvlngsavdlsgcgfsaytskipyiydvqpmttelaqsitdnagsgkl

SCOP Domain Coordinates for d1jrgb_:

Click to download the PDB-style file with coordinates for d1jrgb_.
(The format of our PDB-style files is described here.)

Timeline for d1jrgb_: