SCOPe 2.07: Domain d1jrfa1: 1jrf A:3-47

Lineage for d1jrfa1 (1jrf A:3-47)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.12: LDL receptor-like module [57423] (1 superfamily)
   disulfide-rich calcium-binding fold

4. Superfamily g.12.1: LDL receptor-like module [57424] (2 families)

5. Family g.12.1.1: LDL receptor-like module [57425] (7 proteins)

6. Protein soluble Tva ectodomain, sTva47 [69953] (1 species)
   the viral-binding domain of Tva

7. Species Quail (Coturnix coturnix) [TaxId:9091] [69954] (2 PDB entries)

8. Domain d1jrfa1: 1jrf A:3-47 [71824]
   Other proteins in same PDB: d1jrfa2
   complexed with ca

Details for d1jrfa1

PDB Entry: 1jrf

PDB Description: nmr solution structure of the viral receptor domain of tva

PDB Compounds: (A:) subgroup a rous sarcoma virus receptors pg800 and pg950

SCOPe Domain Sequences for d1jrfa1:

Sequence; same for both SEQRES and ATOM records:

>d1jrfa1 g.12.1.1 (A:3-47) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]}
srcppgqfrcseppgahgecypqdwlcdghpdcddgrdewgcgts

Timeline for d1jrfa1:

• d1jrfa1 first appeared in SCOP 1.61, called d1jrfa_
  
• d1jrfa1 appears in SCOPe 2.06
  
• d1jrfa1 appears in the current release, SCOPe 2.08