Lineage for d1jrfa_ (1jrf A:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 890850Fold g.12: LDL receptor-like module [57423] (1 superfamily)
    disulfide-rich calcium-binding fold
  4. 890851Superfamily g.12.1: LDL receptor-like module [57424] (1 family) (S)
  5. 890852Family g.12.1.1: LDL receptor-like module [57425] (6 proteins)
  6. 890883Protein soluble Tva ectodomain, sTva47 [69953] (1 species)
    the viral-binding domain of Tva
  7. 890884Species Quail (Coturnix coturnix) [TaxId:9091] [69954] (2 PDB entries)
  8. 890886Domain d1jrfa_: 1jrf A: [71824]
    complexed with ca

Details for d1jrfa_

PDB Entry: 1jrf (more details)

PDB Description: nmr solution structure of the viral receptor domain of tva
PDB Compounds: (A:) subgroup a rous sarcoma virus receptors pg800 and pg950

SCOP Domain Sequences for d1jrfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrfa_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]}
gssrcppgqfrcseppgahgecypqdwlcdghpdcddgrdewgcgts

SCOP Domain Coordinates for d1jrfa_:

Click to download the PDB-style file with coordinates for d1jrfa_.
(The format of our PDB-style files is described here.)

Timeline for d1jrfa_: