Lineage for d1jrfa1 (1jrf A:3-47)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033148Fold g.12: LDL receptor-like module [57423] (1 superfamily)
    disulfide-rich calcium-binding fold
  4. 3033149Superfamily g.12.1: LDL receptor-like module [57424] (2 families) (S)
  5. 3033150Family g.12.1.1: LDL receptor-like module [57425] (6 proteins)
  6. 3033183Protein soluble Tva ectodomain, sTva47 [69953] (1 species)
    the viral-binding domain of Tva
  7. 3033184Species Quail (Coturnix coturnix) [TaxId:9091] [69954] (2 PDB entries)
  8. 3033186Domain d1jrfa1: 1jrf A:3-47 [71824]
    Other proteins in same PDB: d1jrfa2
    complexed with ca

Details for d1jrfa1

PDB Entry: 1jrf (more details)

PDB Description: nmr solution structure of the viral receptor domain of tva
PDB Compounds: (A:) subgroup a rous sarcoma virus receptors pg800 and pg950

SCOPe Domain Sequences for d1jrfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jrfa1 g.12.1.1 (A:3-47) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]}
srcppgqfrcseppgahgecypqdwlcdghpdcddgrdewgcgts

SCOPe Domain Coordinates for d1jrfa1:

Click to download the PDB-style file with coordinates for d1jrfa1.
(The format of our PDB-style files is described here.)

Timeline for d1jrfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jrfa2