![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
![]() | Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
![]() | Protein Mn superoxide dismutase (MnSOD) [54721] (9 species) |
![]() | Species Bacillus halodenitrificans [TaxId:1482] [75408] (1 PDB entry) |
![]() | Domain d1jr9a2: 1jr9 A:92-202 [71823] Other proteins in same PDB: d1jr9a1 complexed with mn, zn |
PDB Entry: 1jr9 (more details), 2.8 Å
SCOPe Domain Sequences for d1jr9a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jr9a2 d.44.1.1 (A:92-202) Mn superoxide dismutase (MnSOD) {Bacillus halodenitrificans [TaxId: 1482]} ngggkptgevadkindkygsfekfqeefaaaaagrfgsgwawlvvnngeieimstpiqdn plmegkkpilgldvwehayylkyqnkrpdyisafwnvvnwdevaaqysqaa
Timeline for d1jr9a2: