Lineage for d1jr9a1 (1jr9 A:2-91)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760084Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 760309Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 760310Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 760436Protein Mn superoxide dismutase (MnSOD) [46618] (7 species)
  7. 760445Species Bacillus halodenitrificans [TaxId:1482] [74665] (1 PDB entry)
  8. 760446Domain d1jr9a1: 1jr9 A:2-91 [71822]
    Other proteins in same PDB: d1jr9a2
    complexed with mn, zn; mutant

Details for d1jr9a1

PDB Entry: 1jr9 (more details), 2.8 Å

PDB Description: Crystal Structure of manganese superoxide dismutases from Bacillus halodenitrificans
PDB Compounds: (A:) manganese superoxide dismutase

SCOP Domain Sequences for d1jr9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jr9a1 a.2.11.1 (A:2-91) Mn superoxide dismutase (MnSOD) {Bacillus halodenitrificans [TaxId: 1482]}
kfelpelpyaydaleptidketmnihhtkhhntyvtklngaleghedlknkslndlisnl
davpenirtavrnnggghanhslfwklmsp

SCOP Domain Coordinates for d1jr9a1:

Click to download the PDB-style file with coordinates for d1jr9a1.
(The format of our PDB-style files is described here.)

Timeline for d1jr9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jr9a2