Lineage for d1jr0g_ (1jr0 G:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2058419Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2058420Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 2058421Protein Cholera toxin [50208] (2 species)
    barrel, partly opened; n*=5, S*=10
  7. 2058428Species Vibrio cholerae [TaxId:666] [50209] (26 PDB entries)
    Uniprot P01556 22-124
  8. 2058437Domain d1jr0g_: 1jr0 G: [71818]
    complexed with a24

Details for d1jr0g_

PDB Entry: 1jr0 (more details), 1.3 Å

PDB Description: cholera toxin b-pentamer with ligand bmsc-0011
PDB Compounds: (G:) cholera toxin b subunit

SCOPe Domain Sequences for d1jr0g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jr0g_ b.40.2.1 (G:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

SCOPe Domain Coordinates for d1jr0g_:

Click to download the PDB-style file with coordinates for d1jr0g_.
(The format of our PDB-style files is described here.)

Timeline for d1jr0g_: