SCOPe 2.05: Domain d1jr0g_: 1jr0 G:

Lineage for d1jr0g_ (1jr0 G:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.40: OB-fold [50198] (16 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)

6. Protein Cholera toxin [50208] (1 species)
   barrel, partly opened; n*=5, S*=10

7. Species Vibrio cholerae [TaxId:666] [50209] (24 PDB entries)
   Uniprot P01556 22-124

8. Domain d1jr0g_: 1jr0 G: [71818]
   complexed with a24

Details for d1jr0g_

PDB Entry: 1jr0, 1.3 Å

PDB Description: cholera toxin b-pentamer with ligand bmsc-0011

PDB Compounds: (G:) cholera toxin b subunit

SCOPe Domain Sequences for d1jr0g_:

Sequence; same for both SEQRES and ATOM records:

>d1jr0g_ b.40.2.1 (G:) Cholera toxin {Vibrio cholerae [TaxId: 666]}
tpqnitdlcaeyhntqihtlndkifsyteslagkremaiitfkngatfqvevpgsqhids
qkkaiermkdtlriaylteakveklcvwnnktphaiaaisman

Timeline for d1jr0g_:

• d1jr0g_ first appeared in SCOP 1.61
  
• d1jr0g_ appears in SCOPe 2.04
  
• d1jr0g_ appears in SCOPe 2.06
  
• d1jr0g_ appears in the current release, SCOPe 2.08