Lineage for d1jqye_ (1jqy E:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558996Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 559069Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 559070Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (6 proteins)
  6. 559193Protein Heat-labile toxin [50205] (2 species)
  7. 559194Species Escherichia coli, type IB [TaxId:562] [50206] (19 PDB entries)
  8. 559276Domain d1jqye_: 1jqy E: [71801]

Details for d1jqye_

PDB Entry: 1jqy (more details), 2.14 Å

PDB Description: heat-labile enterotoxin b-pentamer with ligand bmsc-0010

SCOP Domain Sequences for d1jqye_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqye_ b.40.2.1 (E:) Heat-labile toxin {Escherichia coli, type IB}
apqtitelcseyrntqiytindkilsytesmagkremviitfksgetfqvevpgsqhids
qkkaiermkdtlrityltetkidklcvwnnktpnsiaaismkn

SCOP Domain Coordinates for d1jqye_:

Click to download the PDB-style file with coordinates for d1jqye_.
(The format of our PDB-style files is described here.)

Timeline for d1jqye_: