Lineage for d1jqhc_ (1jqh C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2544005Protein Insulin-like growth factor 1 receptor [69825] (1 species)
    PTK group; InsR subfamily; membrane spanning protein tyrosine kinase
  7. 2544006Species Human (Homo sapiens) [TaxId:9606] [69826] (18 PDB entries)
  8. 2544019Domain d1jqhc_: 1jqh C: [71795]
    complexed with anp, mg, so4

Details for d1jqhc_

PDB Entry: 1jqh (more details), 2.1 Å

PDB Description: IGF-1 receptor kinase domain
PDB Compounds: (C:) IGF-1 receptor kinase

SCOPe Domain Sequences for d1jqhc_:

Sequence, based on SEQRES records: (download)

>d1jqhc_ d.144.1.7 (C:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]}
advyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmre
rieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpemennpv
lappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiyet
dyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlr
fvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyse
enk

Sequence, based on observed residues (ATOM records): (download)

>d1jqhc_ d.144.1.7 (C:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]}
advyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmre
rieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpevlapps
lskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtyyrkggkgllp
vrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvlrfvmegglldkpd
ncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyyseenk

SCOPe Domain Coordinates for d1jqhc_:

Click to download the PDB-style file with coordinates for d1jqhc_.
(The format of our PDB-style files is described here.)

Timeline for d1jqhc_: