SCOPe 2.07: Domain d1jqga2: 1jqg A:4P-100P

Lineage for d1jqga2 (1jqg A:4P-100P)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families)

5. Family d.58.3.1: Pancreatic carboxypeptidase, activation domain [54898] (2 proteins)

6. Protein Procarboxypeptidase A [54899] (4 species)

7. Species Cotton bollworm (Helicoverpa armigera) [TaxId:29058] [75429] (1 PDB entry)

8. Domain d1jqga2: 1jqg A:4P-100P [71792]
   Other proteins in same PDB: d1jqga1
   complexed with zn

Details for d1jqga2

PDB Entry: 1jqg, 2.5 Å

PDB Description: Crystal Structure of the Carboxypeptidase A from Helicoverpa Armigera

PDB Compounds: (A:) carboxypeptidase a

SCOPe Domain Sequences for d1jqga2:

Sequence; same for both SEQRES and ATOM records:

>d1jqga2 d.58.3.1 (A:4P-100P) Procarboxypeptidase A {Cotton bollworm (Helicoverpa armigera) [TaxId: 29058]}
heiydghavyqvdvasmdqvklvhdfendlmldvwsdavpgrpgkvlvpkfkreifenfl
kqsgvqyklevenvkeqleledqllaaaaaks

Timeline for d1jqga2:

• d1jqga2 first appeared in SCOP 1.61
  
• d1jqga2 appears in SCOPe 2.06
  
• d1jqga2 appears in the current release, SCOPe 2.08