Lineage for d1jqga2 (1jqg A:4P-100P)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2556533Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families) (S)
  5. 2556534Family d.58.3.1: Pancreatic carboxypeptidase, activation domain [54898] (2 proteins)
  6. 2556535Protein Procarboxypeptidase A [54899] (4 species)
  7. 2556536Species Cotton bollworm (Helicoverpa armigera) [TaxId:29058] [75429] (1 PDB entry)
  8. 2556537Domain d1jqga2: 1jqg A:4P-100P [71792]
    Other proteins in same PDB: d1jqga1
    complexed with zn

Details for d1jqga2

PDB Entry: 1jqg (more details), 2.5 Å

PDB Description: Crystal Structure of the Carboxypeptidase A from Helicoverpa Armigera
PDB Compounds: (A:) carboxypeptidase a

SCOPe Domain Sequences for d1jqga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqga2 d.58.3.1 (A:4P-100P) Procarboxypeptidase A {Cotton bollworm (Helicoverpa armigera) [TaxId: 29058]}
heiydghavyqvdvasmdqvklvhdfendlmldvwsdavpgrpgkvlvpkfkreifenfl
kqsgvqyklevenvkeqleledqllaaaaaks

SCOPe Domain Coordinates for d1jqga2:

Click to download the PDB-style file with coordinates for d1jqga2.
(The format of our PDB-style files is described here.)

Timeline for d1jqga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jqga1