Lineage for d1jqga1 (1jqg A:1-310)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 182572Fold c.56: Phosphorylase/hydrolase-like [53162] (6 superfamilies)
  4. 182719Superfamily c.56.5: Zn-dependent exopeptidases [53187] (5 families) (S)
  5. 182720Family c.56.5.1: Pancreatic carboxypeptidases [53188] (3 proteins)
  6. 182721Protein Carboxypeptidase A [53189] (4 species)
  7. 182722Species Cotton bollworm (Helicoverpa armigera) [TaxId:29058] [75247] (1 PDB entry)
  8. 182723Domain d1jqga1: 1jqg A:1-310 [71791]
    Other proteins in same PDB: d1jqga2

Details for d1jqga1

PDB Entry: 1jqg (more details), 2.5 Å

PDB Description: Crystal Structure of the Carboxypeptidase A from Helicoverpa Armigera

SCOP Domain Sequences for d1jqga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqga1 c.56.5.1 (A:1-310) Carboxypeptidase A {Cotton bollworm (Helicoverpa armigera)}
nstrsrlsfdkihsyeevdaylqelakefpnvvtvveggksfegrsikylristtnfqda
skpvvmmqsllhcrewvtlpatlyaihklvidvtesdlinnidwiilpvanpdgyvhtfg
gdrywrknratgymagnlcmgvdlnrnfgmnwgtassssvcsdtfhgrsafsepessvir
diiaehrnrmalyldihsfgsmilygygngvlpsnalqlhligvqmaqaidrvkwssnkd
yivgnifhvlyaasggasdyamqaaapfsytyelpayrnsvwfdgflvdpdfieqagfet
wegikvgaraaaaaake

SCOP Domain Coordinates for d1jqga1:

Click to download the PDB-style file with coordinates for d1jqga1.
(The format of our PDB-style files is described here.)

Timeline for d1jqga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jqga2