SCOPe 2.07: Domain d1jqeb_: 1jqe B:

Lineage for d1jqeb_ (1jqe B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.19: Histamine methyltransferase [75261] (1 protein)

6. Protein Histamine methyltransferase [75262] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [75263] (7 PDB entries)

8. Domain d1jqeb_: 1jqe B: [71790]
   complexed with qun, sah, unx

Details for d1jqeb_

PDB Entry: 1jqe, 1.91 Å

PDB Description: crystal structure analysis of human histamine methyltransferase (ile105 polymorphic variant) complexed with adohcy and antimalarial drug quinacrine

PDB Compounds: (B:) Histamine N-methyltransferase

SCOPe Domain Sequences for d1jqeb_:

Sequence; same for both SEQRES and ATOM records:

>d1jqeb_ c.66.1.19 (B:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]}
gkyvesfrrflnhstehqcmqefmdkklpgiigrigdtkseikilsigggageidlqils
kvqaqypgvcinnevvepsaeqiakykelvakisnlenvkfawhketsseyqsrmlekke
lqkwdfihmiqmlyyvkdipatlkffhsllgtnakmliivvsgssgwdklwkkygsrfpq
ddlcqyitsddltqmldnlglkyecydllstmdisdcfidgnengdllwdfltetcnfna
tappdlraelgkdlqepefsakkegkvlfnntlsfiviea

Timeline for d1jqeb_:

• d1jqeb_ first appeared in SCOP 1.61
  
• d1jqeb_ appears in SCOPe 2.06
  
• d1jqeb_ appears in the current release, SCOPe 2.08