Lineage for d1joff_ (1jof F:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 170720Fold b.69: 7-bladed beta-propeller [50964] (10 superfamilies)
  4. 170844Superfamily b.69.10: 3-carboxy-cis,cis-mucoante lactonizing enzyme [75011] (1 family) (S)
  5. 170845Family b.69.10.1: 3-carboxy-cis,cis-mucoante lactonizing enzyme [75012] (1 protein)
  6. 170846Protein 3-carboxy-cis,cis-mucoante lactonizing enzyme [75013] (1 species)
  7. 170847Species Neurospora crassa [TaxId:5141] [75014] (1 PDB entry)
  8. 170853Domain d1joff_: 1jof F: [71780]

Details for d1joff_

PDB Entry: 1jof (more details), 2.5 Å

PDB Description: neurospora crassa 3-carboxy-cis,cis-mucoante lactonizing enzyme

SCOP Domain Sequences for d1joff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1joff_ b.69.10.1 (F:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa}
plhhlmigtwtppgaiftvqfddekltcklikrteipqdepiswmtfdherkniygaamk
kwssfavkspteivheashpigghprandadtntraifllaakqppyavyanpfykfagy
gnvfsvsetgkleknvqnyeyqentgihgmvfdptetylysadltanklwthrklasgev
elvgsvdapdpgdhprwvamhptgnylyalmeagnriceyvidpathmpvythhsfplip
pgipdrdpetgkglyradvcaltfsgkymfassrankfelqgyiagfklrdcgsiekqlf
lsptptsgghsnavspcpwsdewmaitddqegwleiyrwkdeflhrvarvripepgfgmn
aiwyd

SCOP Domain Coordinates for d1joff_:

Click to download the PDB-style file with coordinates for d1joff_.
(The format of our PDB-style files is described here.)

Timeline for d1joff_: