Lineage for d1jofc_ (1jof C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2808719Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2809619Superfamily b.69.10: 3-carboxy-cis,cis-mucoante lactonizing enzyme [75011] (1 family) (S)
    automatically mapped to Pfam PF10282
  5. 2809620Family b.69.10.1: 3-carboxy-cis,cis-mucoante lactonizing enzyme [75012] (1 protein)
  6. 2809621Protein 3-carboxy-cis,cis-mucoante lactonizing enzyme [75013] (1 species)
  7. 2809622Species Fungus (Neurospora crassa) [TaxId:5141] [75014] (1 PDB entry)
  8. 2809625Domain d1jofc_: 1jof C: [71777]
    complexed with bme, pin, so4

Details for d1jofc_

PDB Entry: 1jof (more details), 2.5 Å

PDB Description: neurospora crassa 3-carboxy-cis,cis-mucoante lactonizing enzyme
PDB Compounds: (C:) carboxy-cis,cis-muconate cyclase

SCOPe Domain Sequences for d1jofc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jofc_ b.69.10.1 (C:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Fungus (Neurospora crassa) [TaxId: 5141]}
plhhlmigtwtppgaiftvqfddekltcklikrteipqdepiswmtfdherkniygaamk
kwssfavkspteivheashpigghprandadtntraifllaakqppyavyanpfykfagy
gnvfsvsetgkleknvqnyeyqentgihgmvfdptetylysadltanklwthrklasgev
elvgsvdapdpgdhprwvamhptgnylyalmeagnriceyvidpathmpvythhsfplip
pgipdrdpetgkglyradvcaltfsgkymfassrankfelqgyiagfklrdcgsiekqlf
lsptptsgghsnavspcpwsdewmaitddqegwleiyrwkdeflhrvarvripepgfgmn
aiwyd

SCOPe Domain Coordinates for d1jofc_:

Click to download the PDB-style file with coordinates for d1jofc_.
(The format of our PDB-style files is described here.)

Timeline for d1jofc_: