Class b: All beta proteins [48724] (177 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.10: 3-carboxy-cis,cis-mucoante lactonizing enzyme [75011] (1 family) automatically mapped to Pfam PF10282 |
Family b.69.10.1: 3-carboxy-cis,cis-mucoante lactonizing enzyme [75012] (1 protein) |
Protein 3-carboxy-cis,cis-mucoante lactonizing enzyme [75013] (1 species) |
Species Fungus (Neurospora crassa) [TaxId:5141] [75014] (1 PDB entry) |
Domain d1jofa_: 1jof A: [71775] complexed with bme, pin, so4 |
PDB Entry: 1jof (more details), 2.5 Å
SCOPe Domain Sequences for d1jofa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Fungus (Neurospora crassa) [TaxId: 5141]} plhhlmigtwtppgaiftvqfddekltcklikrteipqdepiswmtfdherkniygaamk kwssfavkspteivheashpigghprandadtntraifllaakqppyavyanpfykfagy gnvfsvsetgkleknvqnyeyqentgihgmvfdptetylysadltanklwthrklasgev elvgsvdapdpgdhprwvamhptgnylyalmeagnriceyvidpathmpvythhsfplip pgipdrdpetgkglyradvcaltfsgkymfassrankfelqgyiagfklrdcgsiekqlf lsptptsgghsnavspcpwsdewmaitddqegwleiyrwkdeflhrvarvripepgfgmn aiwyd
Timeline for d1jofa_: