Lineage for d1jo8a_ (1jo8 A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1120542Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1120633Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1120634Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1120654Protein Actin binding protein ABP1 [74920] (1 species)
  7. 1120655Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [74921] (2 PDB entries)
  8. 1120656Domain d1jo8a_: 1jo8 A: [71774]
    complexed with so4

Details for d1jo8a_

PDB Entry: 1jo8 (more details), 1.3 Å

PDB Description: Structural analysis of the yeast actin binding protein Abp1 SH3 domain
PDB Compounds: (A:) actin binding protein

SCOPe Domain Sequences for d1jo8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pwataeydydaaedneltfvendkiiniefvdddwwlgelekdgskglfpsnyvslgn

SCOPe Domain Coordinates for d1jo8a_:

Click to download the PDB-style file with coordinates for d1jo8a_.
(The format of our PDB-style files is described here.)

Timeline for d1jo8a_: